Show pageBacklinksCite current pageExport to PDFBack to top This page is read only. You can view the source, but not change it. Ask your administrator if you think this is wrong. [[Glucagon like peptide 2]] (GLP-2) is a 33 [[amino acid]] [[peptide]] with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational [[proteolytic cleavage]] of [[proglucagon]] in a process that also liberates the related glucagon-like peptide-1 (GLP-1). proglucagon.txt Last modified: 2024/06/07 02:50by 127.0.0.1